General Information

  • ID:  hor005493
  • Uniprot ID:  P09475
  • Protein name:  Pancreatic polypeptide YG(aPY)
  • Gene name:  NA
  • Organism:  Lophius americanus (American angler) (Anglerfish)
  • Family:  NPY family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lophius (genus), Lophiidae (family), Lophioidei (suborder), Lophiiformes (order), Eupercaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YPPKPETPGSNASPEDWASYQAAVRHYVNLITRQRYG
  • Length:  37
  • Propeptide:  YPPKPETPGSNASPEDWASYQAAVRHYVNLITRQRYGXXSSPEEAVAWLLFKADPSQDIEPRLDDDNAW
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005493_AF2.pdbhor005493_ESM.pdb

Physical Information

Mass: 486291 Formula: C189H280N54O57
Absent amino acids: CFM Common amino acids: P
pI: 8.98 Basic residues: 5
Polar residues: 13 Hydrophobic residues: 9
Hydrophobicity: -107.84 Boman Index: -8820
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 47.57
Instability Index: 5660 Extinction Coefficient cystines: 11460
Absorbance 280nm: 318.33

Literature

  • PubMed ID:  3838934
  • Title:  A nonamidated peptide homologous to porcine peptide YY and neuropeptide YY.
  • PubMed ID:  3520508
  • Title:   Anglerfish islets contain NPY immunoreactive nerves and produce the NPY analog aPY.